Home   >  
GPCR/G Protein
  >  
Melanocortin Receptor

Classified by application

All Products

Signaling Pathways

Research Areas

Nature products

Antibodies

Peptides

Catalysts

Impurities

Intermediate

Raw Materials

Melanocortin Receptor

Chemical Structure Cat. No. Product Name CAS No.
Dersimelagon Chemical Structure
 BCP43656 Dersimelagon 1835256-48-8
Dersimelagon is a melanocortin receptor agonist.
Fenoprofen Chemical Structure
 BCP48582 Fenoprofen 31879-05-7
Fenoprofen is a nonsteroidal antiinflammatory drug (NSAID) used in the treatment of acute pain and chronic arthritis. Fenoprofen has been linked to a low rate of serum enzyme elevations during therapy and to rare instances of clinically apparent acute liver injury.
AP1189 acetate Chemical Structure
 BCP46589 AP1189 acetate 959850-74-9
AP1189 is a biased agonist at receptors MC1 and MC3.
AP1189 Chemical Structure
 BCP46590 AP1189 959850-73-8
AP1189 is a biased agonist at receptors MC1 and MC3.
ACTH (4-10) Chemical Structure
 BCP43364 ACTH (4-10) 4037-01-8
ACTH (4-10) is a water soluble potent melanocortin receptor agonist.
Afamelanotide acetate Chemical Structure
 BCP35773 Afamelanotide acetate 1566590-77-9
Afamelanotide is a synthetic α-melanocyte stimulating hormone analogue and first-in-class melanocortin-1 receptor agonist used to?for Erythropoietic Protoporphyria.
Nonapeptide-1 Chemical Structure
 BCP25057 Nonapeptide-1 158563-45-2
Nonapeptide-1, a peptide hormone, is a potent α-Melanocyte-stimulating hormone (α-MSH) antagonist, with an IC50 of 11 nM. Reduces synthesis of melanin and helps decrease skin pigmentation to a substantial degree.
THIQ Chemical Structure
 BCP31597 THIQ 312637-48-2
THIQ is a potent and selective melanocortin 4 receptor agonist (2,3) (IC50= 1.2, 761 and 2067 nM for human MC4, MC3 and MC1 receptors respectively).
Adrenocorticotropic Hormone, Human Chemical Structure
 BCP30218 Adrenocorticotropic Hormone, Human 12279-41-3
Adrenocorticotropic Hormone , human is a melanocortin receptor agonist. Sequence: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe;SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF.
ACTH (1-39) (mouse, rat) Chemical Structure
 BCP30334 ACTH (1-39) (mouse, rat) 77465-10-2
ACTH (1-39) (mouse, rat) is a potent melanocortin 2 (MC2) receptor agonist.
12下一页共 11 条记录 1 / 2 页 
0086-13720134139